lyophilised powder raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
This page was last updated on 2026-08-01 and is reviewed periodically as new material appears.
Melanotan-2 is handled in the laboratory as a lyophilised powder that dissolves readily in water, dimethyl sulfoxide and dimethylformamide, with limited solubility in ethanol. Stock solutions prepared in an organic solvent often precipitate when diluted into aqueous buffer, so gradual dilution with mixing is standard practice. The peptide carries a tryptophan residue and a histidine residue, both sensitive to oxidation and to alkaline conditions. Working solutions are therefore kept near neutral to slightly acidic pH, protected from light, and consumed within the same working session whenever that is practical.
Solid peptide kept dry at minus twenty degrees Celsius, shielded from light and moisture, is generally considered stable for extended periods. Solutions are divided into single-use aliquots and held at minus twenty or minus eighty degrees Celsius, because repeated freeze-thaw cycles promote aggregation and loss of material to container surfaces. Hydrolysis of the backbone and oxidation of tryptophan are the principal degradation routes in aqueous solution, and both accelerate at ambient temperature. Hygroscopic uptake after a vial is opened can also shift the actual mass weighed, which affects any concentration calculated from it.
Routine characterisation relies on reversed-phase high-performance liquid chromatography with ultraviolet detection near 214 nanometres, using a C18 column and a water-acetonitrile gradient containing trifluoroacetic acid. Electrospray ionisation mass spectrometry confirms the expected molecular mass and can reveal truncated or oxidised by-products that co-elute poorly. Sequence and stereochemistry require additional work, such as peptide mapping or amino acid analysis, because a chromatographic purity figure alone does not distinguish a diastereomer from the target peptide. Independent testing of research-grade material frequently shows measured content below the stated label, so a certificate of analysis is best read together with the method that produced it.
Identity and purity are assessed mainly by reversed-phase high-performance liquid chromatography with ultraviolet detection, often paired with mass spectrometry. Retention time supports identity, while the mass spectrum confirms the molecular weight of the intact peptide. Purity is frequently reported as a percentage of total peak area, a figure that depends on the wavelength, column and gradient used. Impurity profiling may also look for truncated sequences, oxidised forms and residual counterions. Amino acid analysis and peptide mapping provide orthogonal confirmation when required.
Regulatory status varies by jurisdiction, and the substance is frequently described as unapproved for therapeutic use. Some authorities classify it alongside prescription-only medicines or controlled categories, while others address it through general consumer protection rules. Analytical surveys have reported mismatches between label claims and measured content in products sold online, although the scope of such testing is limited. Whether these discrepancies are widespread remains an open question. Discussion in the literature therefore tends to combine chemistry, supply-chain observation and policy analysis.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Lyophilised material may be hygroscopic |
| Solubility class | Soluble in water, DMSO and DMF | Dilution into aqueous buffer can cause precipitation |
| Storage of solid | Minus 20 degrees C, desiccated, dark | Aliquot to limit repeated opening of the vial |
| Storage of solution | Minus 20 to minus 80 degrees C, aliquoted | Avoid repeated freeze-thaw cycles |
| Identity method | Reversed-phase HPLC with mass spectrometry | Retention time and mass are checked together |
Handling guidance for melanotan II follows general practice for small synthetic peptides rather than a product-specific monograph. Lyophilized powder is typically kept at minus twenty degrees Celsius or colder, protected from light and moisture, because warmth and humidity accelerate degradation. Once reconstituted, solutions are usually refrigerated and used within a short window, as hydrolysis and microbial growth both become concerns. Repeated freeze-thaw cycles are generally avoided. These conventions come from laboratory peptide chemistry and not from formal stability studies on this specific compound.
Analytical confirmation of identity relies on mass spectrometry, most often coupled to liquid chromatography. Reversed-phase high-performance liquid chromatography separates the peptide from related impurities and provides a purity estimate based on peak area. Electrospray ionization mass spectrometry then confirms the expected molecular mass, while tandem mass spectrometry can map the fragment sequence. For research-grade material, these two techniques together form the standard minimum. Purity figures reported by vendors are frequently not traceable to an independent laboratory.
Independent verification is central to quality control because the compound is not produced under pharmaceutical manufacturing standards. Third-party laboratories can measure purity, identity, residual solvents, and microbial contamination, though the scope of testing varies between services. Reported analyses of vendor samples have shown batch-to-batch variation in peptide content and the presence of truncated or oxidized species. How much of this variation reflects synthesis conditions versus storage and shipping is not well characterized. No harmonized reference standard exists for the material as sold.
Identity testing for a cyclic peptide of this size usually relies on reversed-phase high-performance liquid chromatography coupled to mass spectrometry. The mass spectrum confirms molecular weight, while the chromatographic trace indicates the proportion of related impurities. Tandem mass spectrometry can provide sequence-level information when fragmentation data are compared against a reference standard. Nuclear magnetic resonance is sometimes used to confirm the lactam bridge, although it requires more material and greater operator expertise than routine chromatographic methods.
Lyophilised peptide powder is comparatively stable when kept dry, cold and protected from light. Once dissolved, the molecule is exposed to hydrolysis, oxidation and microbial growth, and degradation accelerates at higher temperatures and in alkaline solution. Repeated freeze-thaw cycles concentrate solutes and promote aggregation. Handling guidance for research peptides commonly clusters around freezer temperatures for powder and short refrigerated use for reconstituted solutions, with pH control and sterile technique applied throughout.
Verification of a purchased sample requires documentation linking a batch to a certificate of analysis, and that document should be read for the methods used rather than the headline purity figure. A single chromatographic percentage does not establish identity. Independent laboratories can perform identity and content assays, but no such test establishes that a product is suitable for human use. Claims about efficacy rest largely on small, early studies rather than on replicated controlled trials, and that gap remains open.
== Chemistry == Bulevirtide is a 47-amino acid long lipopeptide with the following sequence: CH3(CH2)12CO-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2 (C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2)
==== Organ development ==== Since serotonin signals resource availability it is not surprising that it affects organ development. Many human and animal studies have shown that nutrition in early life can influence, in adulthood, such things as body fatness, blood lipids, blood pressure, atherosclerosis, behavior, learning, and longevity. Rodent experiment shows that neonatal exposure to SSRIs makes persistent changes in the serotonergic transmission of the brain resulting in behavioral changes, which are reversed by treatment with antidepressants. By treating normal and knockout mice lacking the serotonin transporter with fluoxetine scientists showed that normal emotional reactions in adulthood, like a short latency to escape foot shocks and inclination to explore new environments were dependent on active serotonin transporters during the neonatal period. Human serotonin can also act as a growth factor directly. Liver damage increases cellular expression of 5-HT2A and 5-HT2B receptors, mediating liver compensatory regrowth (see Liver § Liver regeneration) Serotonin present in the blood then stimulates cellular growth to repair liver damage. 5-HT2B receptors also activate osteocytes, which build up bone. However, serotonin also inhibits osteoblasts, through 5-HT1B receptors.
== P == Pasteurella Pasteurella canis Pasteurella multocida Peptostreptococcus anaerobius Photobacterium damselae subsp. damselae (previously Vibrio damsela) Porphyromonas gingivalis Prevotella melaninogenica (formerly Bacteroides melaninogenicus) Proteus Proteus mirabilis Proteus penneri Proteus vulgaris Pseudomonas aeruginosa
In conditioned fear models, antalarmin reduced conditioned freezing behavior, suggesting that it blocked the development and expression of conditioned fear, and implicating CRH1 receptors in both processes. Oral administration of antalarmin (3–30 mg/kg) also significantly reduced immobility in a rat model of behavioral despair, with effects similar to the SSRI fluoxetine.
Sources: en.wikipedia.org
=== Interviews and Reviews === Horton, Richard (5 March 1997), Use of Weapons: Review, archived from the original on 28 January 2017, retrieved 17 February 2009. Johnson, Greg L. (2008), "Matter (review)", SF Site, archived from the original on 4 June 2008, retrieved 4 August 2021. Langford, David (1998), "Iain M. Banks: Inversions", Ansible.uk, retrieved 4 August 2021. Parsons, Michael (14 October 2010), "Interview: Iain M Banks talks 'Surface Detail' with Wired", Wired, retrieved 2 August 2021.
=== South Africa === The species has been protected in South Africa since 1991; with laws banning both deliberate killing and selling. In the province of KwaZulu-Natal (KZN), the KwaZulu-Natal Sharks Board employs nets around protected beaches to mitigate the risk of shark attacks, though these are excluded from major aggregation sites. Population estimates have varied: a 1996 study estimated an average of 1,279 individuals between 1989 and 1993, while a 2004 study suggested the population had grown to 1,953 post-protection. A 2023 study concluded that white shark numbers off South Africa have remained stable since 1991, despite declines in sightings at Western Cape. Researchers suggested the population may be shifting eastward, potentially in response to orca predation. However, these findings are disputed; in 2024, it was noted that white shark catches in KZN have actually declined since 2010, casting doubt on the theory of an eastward migration.
== Signs and symptoms == Yaws primarily occurs in children, most frequently in those aged 6–10. Yaws is classified as primary, secondary, and tertiary; this can be clinically useful, but infected patients often have a mix of stages. Within 9–90 days (but usually about 21 days) of infection, a painless but distinctive "mother yaw" nodule appears. Initially reddened and inflamed, it may become a papilloma, which can then become an ulcer, possibly with a yellow crust. Mother yaws are most commonly found on the legs and ankles, and are rarely found on the genitals (unlike syphilis). The mother yaw enlarges and becomes warty in appearance. Nearby "daughter yaws" may also appear simultaneously. This primary stage resolves completely, with scarring, within 3–6 months. The scar is often pigmented.
Sources: en.wikipedia.org
Purity is normally stated as an area percentage from high-performance liquid chromatography, for example ninety-five or ninety-eight percent. That figure describes the proportion of ultraviolet-absorbing material eluting as the main peak. It says nothing about water content, counterions, residual solvents or mass fraction of the peptide itself.
Peptides are commonly isolated as acetate or trifluoroacetate salts, and the counterion contributes to total mass. Two vials with identical peptide content can therefore differ in weight and in measured response. Residual trifluoroacetate is also relevant in cell-based work because it can influence membrane behaviour.
Degradation products are often closely related to the parent molecule, making them hard to resolve with a single method. Counterion variability adds a further source of scatter between laboratories. Because no pharmacopoeial monograph exists for melanotan-2, groups rely on method-specific validation rather than a shared reference standard.
The dry powder is more stable during transport and storage than a solution. It also allows a known amount of material to be reconstituted at a chosen concentration.